If you have been reading about Nicotinamide mononucleotide and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-02-03. Numbers and descriptions here follow the published literature rather than marketing material.
In the salvage pathway, NMN is generated from nicotinamide and 5-phosphoribosyl-1-pyrophosphate by the enzyme nicotinamide phosphoribosyltransferase. A second route produces NMN from nicotinamide riboside through phosphorylation by nicotinamide riboside kinases. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferases, often called NMNAT enzymes. This stepwise route allows cells to recycle nicotinamide and maintain NAD+ levels under changing metabolic conditions. The relative contribution of each route varies by tissue, species, and physiological state, and it remains an active area of research.
Research on NMN has expanded because NAD+ concentrations decline with age in some tissues and because NAD+ participates in energy metabolism, DNA repair, and signaling. Animal studies have reported changes in NAD+ levels after NMN administration, but human data are more limited and often focus on safety, pharmacokinetics, and biomarker changes. Questions remain about oral absorption, tissue distribution, and whether changes in blood NAD+ reflect changes inside specific organs. NMN is not an approved drug, and claims about its clinical effects should be distinguished from established biochemical findings.
Quality control for NMN materials usually covers identity, assay purity, residual solvents, heavy metals, microbial limits, and moisture content. Certificates of analysis from suppliers may report high-performance liquid chromatography purity, mass spectrometry identity, and elemental impurity testing. Regulatory treatment differs by country: NMN is not an approved drug, and its status as a dietary supplement ingredient or novel food has been debated. Some authorities have restricted sales pending safety and regulatory review, while others allow it under specific categories. Buyers should verify documentation rather than rely on label claims.
Quantifying NMN requires methods that separate it from structurally similar compounds such as nicotinamide, nicotinamide riboside, and NAD+. Common approaches include high-performance liquid chromatography coupled with ultraviolet detection, liquid chromatography with tandem mass spectrometry, capillary electrophoresis, and nuclear magnetic resonance for identity confirmation. Because NMN is polar and often present at low concentrations in biological samples, sample preparation can involve protein precipitation, solid-phase extraction, or derivatization. Isotope-labeled internal standards help correct for matrix effects and recovery losses. Reported concentrations depend heavily on the matrix, extraction protocol, and analytical platform.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C11H15N2O8P | Pyridinium nucleotide; free acid form |
| Molar mass | 334.22 g/mol | Free acid; salt forms differ |
| Appearance | White to off-white powder | Typical reference material |
| Solubility class | Water-soluble | Hygroscopic under humid conditions |
| Common synonyms | Nicotinamide mononucleotide; NMN | Distinct from nicotinamide riboside |
Natural sources of NMN include mammals, plants, and microorganisms, where it functions as an intermediate in NAD+ salvage and biosynthesis pathways. In mammals, the enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferase. Some foods contain measurable NMN, but reported amounts vary widely by species, tissue, and analytical method. The extent to which dietary NMN contributes to cellular NAD+ pools remains an open research question.
Chemically, NMN is described by the molecular formula C11H15N2O8P and a molecular mass near 334.22 g/mol. The beta anomer has a CAS Registry Number of 1094-61-7. It is typically supplied as a white to off-white powder for laboratory use. The molecule carries a phosphate group and a positively charged nicotinamide ring, giving it polar and water-soluble character. These properties influence how it is detected, purified, and stored in research and analytical laboratories.
Analytical identification of NMN usually combines chromatographic separation with mass spectrometric detection. High-performance liquid chromatography coupled to tandem mass spectrometry is common for quantifying NMN in biological matrices and finished materials. Because NMN and related nucleotides share similar masses and retention behavior, method development must resolve potential interferences such as nicotinamide riboside and NAD+. Ultraviolet detection at approximately 260 nm can be used for purity checks when concentrations are sufficient. Nuclear magnetic resonance spectroscopy provides structural confirmation and can distinguish anomeric forms.
Stability testing examines how temperature, humidity, light, and pH affect NMN over time. The compound is generally considered hygroscopic and may degrade faster in aqueous solution than in dry powder form. Phosphate esters can hydrolyze under strongly acidic or alkaline conditions, and elevated temperatures accelerate such reactions. For storage, sealed containers at low temperature with desiccant are typical laboratory practices. Stability-indicating methods should separate NMN from its degradation products, including nicotinamide and nicotinamide riboside, so that purity loss can be tracked accurately.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in cells. Its structure combines a nicotinamide ring, a ribose sugar, and a phosphate group. As an intermediate in the NAD+ salvage pathway, NMN is converted to nicotinamide adenine dinucleotide, a coenzyme central to cellular redox reactions. NAD+ also serves as a substrate for enzymes involved in DNA repair, stress responses, and metabolic regulation. The compound is therefore part of normal cellular biochemistry rather than an exclusively synthetic molecule.
Two enzymatic steps define the canonical route from nicotinamide to NAD+. Nicotinamide phosphoribosyltransferase, known as NAMPT, produces NMN from nicotinamide and phosphoribosyl pyrophosphate. NMN adenylyltransferases, or NMNAT enzymes, then couple NMN with ATP to form NAD+. Whether intact NMN crosses cell membranes efficiently remains an active area of investigation; some studies propose direct transport, while others emphasize extracellular dephosphorylation to nicotinamide riboside followed by uptake. The relative contribution of each route likely depends on cell type, tissue, and experimental conditions.
Trace amounts of NMN have been reported in certain plant foods, including edamame, avocado, broccoli, cucumber, and cabbage. Reported concentrations vary widely because analytical methods differ and food matrices complicate extraction. Endogenous production in cells is generally considered more quantitatively important than dietary intake, though precise human turnover rates are difficult to establish. Commercial NMN for research or consumer products is commonly made through enzymatic synthesis or chemical phosphorylation routes. Regulatory classification differs by country; in some jurisdictions NMN is sold as a supplement, while in others it is treated as a novel food ingredient or restricted substance.
=== EC 1.8.5 With a quinone or similar compound as acceptor === EC 1.8.5.1: glutathione dehydrogenase (ascorbate) EC 1.8.5.2: thiosulfate dehydrogenase (quinone) EC 1.8.5.3: respiratory dimethylsulfoxide reductase EC 1.8.5.4: bacterial sulfide:quinone reductase EC 1.8.5.5: thiosulfate reductase (quinone) EC 1.8.5.6: sulfite dehydrogenase (quinone) EC 1.8.5.7: glutathionyl-hydroquinone reductase EC 1.8.5.8: eukaryotic sulfide quinone oxidoreductase EC 1.8.5.9: protein dithiol:quinone oxidoreductase DsbB EC 1.8.5.10: DsrC-trisulfide reductase
== History == In 1959, physicist Richard Feynman gave a talk titled "There's Plenty of Room at the Bottom" to the American Physical Society. He imagined a world in which "we could arrange atoms one by one, just as we want them." This idea set the stage for the bottom-up synthesis approach in which constituent components interact to form higher-ordered structures in a controllable manner. The study of self-assembly of nanoparticles began with recognition that some properties of atoms and molecules enable them to arrange themselves into patterns. A variety of applications where the self-assembly of nanoparticles might be useful. For example, building sensors or computer chips. Definition Self-assembly is defined as a process in which individual units of material associate with themselves spontaneously into a defined and organized structure or larger units with minimal external direction. Self-assembly is recognized as a highly useful technique to achieve outstanding qualities in both organic and inorganic nanostructures. According to George M.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES. In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
=== 1970: In the Wake of Poseidon and Lizard === King Crimson spent 1970 in a state of flux with various line-up changes, thwarted tour plans, and difficulties in finding a satisfactory musical direction, while Fripp was learning and developing as a songwriter during the writing process of the next three albums. As well as guitar, Fripp took on keyboard duties, while Sinfield expanded his creative role to operating synthesizers. Following McDonald's and Giles's departure, Lake, unsure of the band's future without them, began discussions with Keith Emerson of the Nice about possibly forming a new band together. With Fripp and Sinfield planning the recording of the second King Crimson album, and Lake's position uncertain, the band's management booked Elton John to sing on the album, a decision cancelled by Fripp after he listened to John's then-only album, Empty Sky, and deemed his singing style to be not right for King Crimson. Lake agreed to stay with the band until Emerson had completed remaining commitments with the Nice, at which point he left to form Emerson, Lake & Palmer with Emerson and Carl Palmer of Atomic Rooster. On the resulting In the Wake of Poseidon album, Lake provided all the lead vocals except on "Cadence and Cascade", which featured Fripp's old school friend Gordon Haskell. The sessions also included Michael and Peter Giles on drums and bass respectively, saxophonist Mel Collins (formerly of the band Circus), and jazz pianist Keith Tippett. Upon its release in May 1970, In the Wake of Poseidon reached No. 4 in the UK and No. 31 in the US.
Two principal varieties are used: Camellia sinensis var. sinensis, which is used for most Chinese, Formosan and Japanese teas, and C. sinensis var. assamica, used in Pu-erh and most Indian teas (but not Darjeeling). Within these botanical varieties, many strains and modern clonal varieties are known. Leaf size is the chief criterion for the classification of tea plants, with three primary classifications being: Assam type, characterised by the largest leaves; China type, characterised by the smallest leaves; and Cambodian type, characterised by leaves of intermediate size. The Cambodian-type tea (C. assamica subsp. lasiocaly) was originally considered a type of Assam tea. However, later genetic work showed that it is a hybrid between Chinese small-leaf tea and Assam-type large-leaf tea. Darjeeling tea appears to be another hybrid of the same sort.
Sources: en.wikipedia.org
In horticulture, lime sulfur (lime sulphur in British English; see American and British English spelling differences) is mainly a mixture of calcium polysulfides and thiosulfate (plus other reaction by-products such as sulfite and sulfate), formed by reacting calcium hydroxide with elemental sulfur, and is used in pest control. It can be prepared by boiling a suspension of poorly soluble calcium hydroxide (lime) and solid sulfur in water, together with a small amount of surfactant to facilitate the dispersion of these solids. After elimination of residual solids (flocculation, decantation, and filtration), it is normally used as an aqueous solution, which is reddish-yellow in color and has a distinctive offensive odor of hydrogen sulfide (H2S, rotten eggs).
Chloramphenicol binds to residues A2451 and A2452 in the 23S rRNA of the ribosome and inhibits peptide bond formation. Pleuromutilins also bind to the peptidyl transferase center. Macrolide antibiotics are thought to inhibit peptidyl transferase, in addition to inhibiting ribosomal translocation.
Pappalysin-1, also known as pregnancy-associated plasma protein A, and insulin-like growth factor binding protein-4 protease is a protein encoded by the PAPPA gene in humans. PAPPA is a secreted protease whose main substrate is insulin-like growth factor binding proteins. Pappalysin-1 is also used in screening tests for Down syndrome.
== Lysis buffer in DNA and RNA studies == In studies like DNA fingerprinting the lysis buffer is used for DNA isolation. Dish soap can be used in a pinch to break down the cell and nuclear membranes, allowing the DNA to be released. Other such lysis buffers include the proprietary Qiagen product Buffer P2.
Sources: en.wikipedia.org
NMN stands for nicotinamide mononucleotide. It is a naturally occurring nucleotide and an intermediate in the cellular production of NAD+.
No. NMN is a smaller precursor molecule, while NAD+ is a dinucleotide cofactor used in many reactions. Enzymes called NMNAT convert NMN into NAD+ inside cells.
This question is not fully settled. Some evidence suggests NMN may be dephosphorylated to nicotinamide riboside before uptake, while other studies propose direct transport. Tissue-specific handling in humans remains an open research area.
Liquid chromatography with tandem mass spectrometry is common because it can quantify low levels of NMN in complex samples. High-performance liquid chromatography with ultraviolet detection is used for simpler purity checks. Nuclear magnetic resonance can confirm identity and detect some impurities.